General Information

  • ID:  hor001934
  • Uniprot ID:  P81880
  • Protein name:  Glucagon
  • Gene name:  GCG
  • Organism:  Piaractus mesopotamicus (Pacu)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Piaractus (genus), Serrasalmidae (family), Characoidei (suborder), Characiformes (order), Characiphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSEGTFSNDYSKYLETQRAQDFVQWLMNS
  • Length:  29(1-29)
  • Propeptide:  HSEGTFSNDYSKYLETQRAQDFVQWLMNSXXXXXXXXHADGTYTSDVSAYLQDQAAKDFITWLKSGQPKQE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  X's in the sequence were included by homology with other fish sequences.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001934_AF2.pdbhor001934_ESM.pdb

Physical Information

Mass: 398234 Formula: C153H221N41O51S
Absent amino acids: CIP Common amino acids: S
pI: 4.54 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -105.17 Boman Index: -7784
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 40.34
Instability Index: 2301.03 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  10327603
  • Title:  Purification and Characterization of Insulin and Peptides Derived From Proglucagon and Prosomatostatin From the Fruit-Eating Fish, the Pacu Piaractus Mesopotamicus